DPCstruct | MC55802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 9.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7VTW0 | 4-81 | YDPKERFRYLRELVTEFQDTKSAEAKEQVLANLANFAYDPVNYEHFKRLNIVNLFIDQLDSGSDALKEYAIGGICNLA |
| F4P6Y5 | 2-100 | FQTAAYINSRTGSKDLNRFDYLQLLVCEYEASLLYSNLPYSEPERHEKLARLSNFAYDPINHDFLWQLNIVELFLDAIHISSTDPIA… |
| A0A7R9AG93 | 52-132 | None |
| A0A2R6X9H1 | 14-95 | None |
| A0A671SR26 | 1-77 | None |
| A0A482VG50 | 13-91 | None |
| A0A6P7EFC7 | 1-92 | None |
| A0A7R9QPD1 | 3-90 | None |
| A0A834J3J3 | 17-89 | None |
| A0A287FIB6 | 62-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.