DPCstruct | MC55794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 184 ± 26 aa |
| Standard deviation of domain lengths | 26.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7EXA9 | 5-165 | CRQDNYFVVKRFRFLVVWDPDSLWRKNTHGRIPLHSAALHRAMQRFQFVFGYGIYYYPNKKGINLVFHQGVSGQTPFQLACEKHGRD… |
| A0A1E7FTM1 | 286-427 | DANSFSSEVFQFLVTWDPVQLITANDDHTRQLPLHHAAYHCSLDYFQAVFEAGLRYFPRKMGIYILFQKRRWRYTPFDRACWRYGRE… |
| A0A1E7EX04 | 404-594 | None |
| A0A7S3VGK5 | 244-465 | None |
| A0A1E7EWL4 | 3-137 | None |
| A0A1E7EYJ2 | 98-272 | None |
| A0A1E7EZ69 | 217-396 | None |
| A0A1E7F0F2 | 67-256 | None |
| A0A1E7EYF4 | 239-399 | None |
| A0A1E7ET19 | 239-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.