DPCstruct | MC55785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 9.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W2DQA3 | 3-95 | MPMPNASTQVFLKKISSFCEQRLAPHFSATDYENIRCYMLGLVARGVMPPHHGGKIDWQEIAVACNLEGESLAEAKRQTLHGFAAIT… |
| A0A7W8X998 | 1-96 | MPRLPASPSVFRQKISSFCDLRLACTLSSHDHENLRSYMLGFVTRREKPPQNAGKLDWKQIAMACDLNGESLRFAKQVARHGFDAIV… |
| A0A4R3X9S2 | 3-108 | None |
| A0A840A8A5 | 5-105 | None |
| A0A2N3C596 | 7-107 | None |
| A0A4R1X2D1 | 1-90 | None |
| A0A6S6NFQ1 | 1-94 | None |
| A0A1R3U108 | 7-89 | None |
| A0A8A7ARI2 | 1-91 | None |
| A0A7K1R626 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.