DPCstruct | MC55783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 142 ± 21 aa |
| Standard deviation of domain lengths | 21.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7X3P5 | 2-130 | ARYADLSADQILEKILFDGIVDADEVEALREKLEQDWVVDHSEVELLFRVNHSLGGKAEDCPEWTAFFVDNVSRLLILDLDTPGEID… |
| A0A7W8UGB5 | 1-148 | MTAKDVDVLREHVFAGGLTSSQDAMILLAINSSCSEKCPGWHHYFIETMTDFIVHRTEPQGSVDEWNADWLIAMISTRGVINSRPEL… |
| A0A353G0W9 | 1-134 | None |
| A0A844YQF2 | 8-185 | None |
| A0A2N2KS72 | 3-123 | None |
| A0A657LTE7 | 21-199 | None |
| A0A1W9MZQ0 | 611-724 | None |
| A0A1M3NP00 | 6-142 | None |
| A0A2Z3GUA1 | 7-140 | None |
| A0A6M8VP89 | 9-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.