DPCstruct | MC55781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 111 ± 23 aa |
| Standard deviation of domain lengths | 22.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 34.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03302 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V6TVA0 | 123-229 | VDQCTASTTGTDGCQNCGAEIGEAYYCSTCNSAAQVPINGVCADHSPVSRNTICTYALDGKCRTCAGDYFRFAGGCYETGQQPGQQI… |
| C6LNK7 | 20-118 | ACDAIVIGASGEMTYYCSLCGDSTKIPIDGKCVPSSSANGNTCENGVCKSCTANYFLYMGGCYKVDTTPGNLMCSKATTAGVCDTLN… |
| V6TSC2 | 77-189 | None |
| A0A132NUQ7 | 255-350 | None |
| V6TRK2 | 15-130 | None |
| V6TS64 | 92-250 | None |
| V6TSX5 | 1-136 | None |
| V6TTM0 | 76-159 | None |
| V6TUB3 | 145-241 | None |
| V6TUQ4 | 84-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.