DPCstruct | MC55775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 368 ± 32 aa |
| Standard deviation of domain lengths | 32.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9VTE6 | 9-368 | AQIAGLQEEVTQAMQIASRHGDEHTGEGLDPYEPKAANVLLPIIGEPTYDDGEDANTLFHSAGWFSGGVVSDVGGGNVTISAGTGVL… |
| A0A0F9KIC8 | 162-498 | LGSFNGIFLEKLNFTISYSSPTVTGSLEQDGGGDLIQKFSDGYTTLDCTDPVLTIDLTTYVGTDAVPKEVFVYILQSDKTTIVASNT… |
| A0A7C1P2S3 | 294-694 | None |
| A0A7C7R6Q2 | 158-502 | None |
| A0A0F9SYZ0 | 2-391 | None |
| A0A0F9T0H6 | 376-769 | None |
| A0A0F9T4U5 | 13-346 | None |
| A0A496WSB5 | 302-716 | None |
| A0A0F9RME1 | 123-476 | None |
| A0A7X5Q2H7 | 19-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.