DPCstruct | MC55774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 154 ± 20 aa |
| Standard deviation of domain lengths | 20.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9VSD9 | 4-145 | NSNKVAEQNTFFDATPAPVIVNFNDLWETFKRIYSKNRSVYKKVFKNNVFKKLEILYHTNEKNVNFDIKLWVLILSTYLYAYKNANA… |
| A0A7X9DEI3 | 118-271 | MEHYEPYWKNIEGSKPVPTFGDIDIIEPEAIEVNLQRLVDEFKTGFIQFNALYREMFSNQVFTSLKDSAHMDVESFNMPVEIWVKIV… |
| A0A7G9YYK4 | 138-347 | None |
| K1YCP7 | 31-201 | None |
| X1BMJ4 | 6-133 | None |
| A0A1F5B6G2 | 1-114 | None |
| A0A535EC21 | 4-143 | None |
| A0A7C1L4M2 | 18-190 | None |
| A0A532EUQ0 | 3-154 | None |
| A0A7C1W2W6 | 32-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.