DPCstruct | MC5577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 5.82 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7SAN4 | 1-66 | MVENRADLLIKLAERLSRRGQRLHFCYEAGPCGYGLHRLLSGLGHDCTVVAPSLIPKKPGDRVKTN |
| A0A3D2Z621 | 1-80 | MIYSDIANRPEAVAKLAHRLDDGKTRLRFCYGAGPCGYGVFRQLTQMGHECTVVASSMIPRRPGDRIRPEAKPAAKWLQP |
| A0A543KBF0 | 32-103 | None |
| A0A7C7DIX5 | 47-106 | None |
| A0A7R7C9I0 | 28-90 | None |
| A0A2H5ZYE0 | 2-70 | None |
| A0A0U1NQU4 | 1-75 | None |
| A0A1B1CN44 | 11-76 | None |
| A3WU24 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.