DPCstruct | MC55768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 105 ± 19 aa |
| Standard deviation of domain lengths | 18.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2YH79 | 2-112 | NLRAFGEENPAEDAKPVNARASTLDYAKKDPSSFMPRCTVPWDPIRNEGNPTRSDLVNAVIKKVKRSEVRREGVQSAARRPVDYEEF… |
| A0A225VBE7 | 44-141 | MNQQAYGDPEPNELMKPVHRRSSTLEFAKKAISSFMPRINTTWDPVTERGNPTRSDAVNKLIKKVKKFEVRREGAESKARRAVEFAE… |
| A0A1E7FWK1 | 154-240 | None |
| W2LP96 | 46-129 | None |
| A0A5J4Z1U2 | 47-154 | None |
| D0MW69 | 46-145 | None |
| A0A0G4FPS1 | 77-196 | None |
| K0RVC9 | 110-240 | None |
| A0A0G4EYZ7 | 52-220 | None |
| A0A080ZZU4 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.