DPCstruct | MC55750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 174 ± 12 aa |
| Standard deviation of domain lengths | 11.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9VP13 | 1-157 | MGNTVDFTKQQIVSHIRALEYSLMITEDYKTALKLVEEEQKYLTIMKTNGKTSSPETNGLAYLDYLTGTWLVEPLWKSWSQYGRSQA… |
| A0A0C3DPJ7 | 292-466 | AWRNGLNRKLRVIPRGDERQQTQRMLATFLFKLLKDVDKFEDAVAVFNAQLVQFQELGNNQDAILQKKSQGGLAFMAYLHSYIKISD… |
| A0A2N0RWC0 | 28-200 | None |
| A0A397SIM1 | 266-439 | None |
| A0A4Q9NKL4 | 186-361 | None |
| S7QAI7 | 703-891 | None |
| B8PM27 | 759-935 | None |
| A0A2N1M884 | 1-151 | None |
| A0A0K6GHW8 | 579-749 | None |
| A0A165IMF0 | 94-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.