DPCstruct | MC5575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 6.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A142XK88 | 94-172 | AIEGDGFFQITLPNGDIAYTRVGNFGVAADGCLVTAQGYRVSPQIKVPPQAVSFCVGSDGTVSVQQAGALNASTVLGQL |
| A0A2B4R383 | 86-163 | AISGNGLFQVQLPTGEIAYTRNGEFKKSSDGTIVTLDGYTIQPGITIPPDALSVRVNDEGEVYAKIDGQQEPQLLGQF |
| A0A6I1KIR1 | 108-172 | None |
| A0A7Y5RNE1 | 70-146 | None |
| A0A4Q4WIE6 | 94-174 | None |
| A0A060QLU3 | 43-120 | None |
| A0A1E7DGR0 | 1-93 | None |
| A0A7Z0DY16 | 96-173 | None |
| A0A831UTU1 | 86-156 | None |
| A0A6G0XZ50 | 605-682 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.