DPCstruct | MC55741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 132 ± 11 aa |
| Standard deviation of domain lengths | 11.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7K2L0 | 1-140 | MNQCRHINVRIDPVGLREGVHYTEVCGYDTAAPTCGPLFRVPITVIIPAKVTDGRNQEVRFSDVHFRSGQIRRHFVTVPQGASWAEI… |
| A0A0M3K829 | 4-139 | QQRQFAIRIDPTGLETSVAHFTEIKAFDSRNPSLGPLFRVPITTIVPLTVDSSNQFTISRKLRCKPAVPERLFIHVPDDADWATLKV… |
| A0A6H5GJE3 | 616-741 | None |
| A0A0S7JZK3 | 277-416 | None |
| A0A672SJJ0 | 277-407 | None |
| A0A820Y6E6 | 234-349 | None |
| A0A7R8W8K2 | 205-358 | None |
| A0A817UQC6 | 628-742 | None |
| A0A1Y3AN36 | 129-253 | None |
| A0A1B0GJ21 | 387-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.