DPCstruct | MC55740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 226 ± 29 aa |
| Standard deviation of domain lengths | 28.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7JPL4 | 1-197 | MFLWGQAMYNIAKLLADELISPKDIDPIHRYVPRQDQRNVSMRYSNQGPIDNDAVIHVSLVAESQRLQVFLNTYGIQTQTPQQVEPI… |
| A0A1S3MTL0 | 275-518 | LIRGKPGICLMPELYAVPPEKMEEEYGNPHSVDRVAMGQLPHMWGQSLYIVSSLLAEGFLAPGEIDPLNRRFSTNFKPDVVVQVCVL… |
| A0A7M5WZH5 | 57-268 | None |
| A0A1I8ILZ9 | 66-296 | None |
| A0A814TIM8 | 14-233 | None |
| A0A183MU10 | 38-253 | None |
| T1GV73 | 137-314 | None |
| A0A5K3EH41 | 381-599 | None |
| A0A5K3EIZ4 | 174-388 | None |
| A0A1Y1Y6Z0 | 302-571 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.