DPCstruct | MC5574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 116 ± 24 aa |
| Standard deviation of domain lengths | 23.53 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09996 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A062SN03 | 1-75 | MTSDFLNFSQKVGNDLITPLPEAGFPGLQPGDFWCICVTRWVEAYQAGQAPPVKLHACHQAVLSYVPLDVLMEYA |
| A0A3D2RTP8 | 159-276 | GRNVLGGELIGCSTDPMTGYMRDGCCRNVPGDMGLHILCAEITSEFLEFSKSVGNDLSTPHPEFGFDGLKPGDRWCLCVNRWVEAME… |
| R9P4G4 | 805-930 | None |
| B7FWD1 | 13-136 | None |
| A0A178AWR0 | 3-84 | None |
| A0A7W0YW49 | 1-56 | None |
| A0A813MN09 | 12-114 | None |
| M1VDB1 | 48-168 | None |
| A0A061RNQ1 | 12-164 | None |
| A0A4Z1HJX3 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.