DPCstruct | MC55736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 154 ± 10 aa |
| Standard deviation of domain lengths | 9.95 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18863 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A564ZP31 | 1-160 | MTSFSQRKGLKPIRQALQVDGMDDELRAQLWNVLHFHLWDSKGFLHTDYGEVGRIAEFARALWVRYFKKPFTEIPSWPSQVLSLLKD… |
| A0A653SWN8 | 51-203 | MPSFSERYGHREVRTVIQREAIDESARVALWNVVYLFVKNMQEEYRFSDLSPHQDLAVEFWADHLKRPLDEFPSQTTVWQLIKNQVL… |
| A0A3M9ZGR8 | 1-143 | None |
| A0A2C6UUF5 | 1-143 | None |
| A0A2N8IR82 | 8-158 | None |
| A0A2P8GSQ3 | 126-299 | None |
| A0A1M4WDV9 | 1-145 | None |
| A0A1R3WVL7 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.