DPCstruct | MC55733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 128 ± 16 aa |
| Standard deviation of domain lengths | 15.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01890 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I0FXH2 | 5-120 | GCERRTPAEEVIALAERALADAGVAPGDLRLVASLDARAEEPAILAAAQHFSVPAAFYDAATLEAEASRLANPSEIVFAYTGCHGVA… |
| A0A7G1KH69 | 2-109 | GFRPGAEAAVIVAAVREVVGGRWLRCLATVERRAGEQGLIGAAEELGVEIVSFPAERLAAVQVPNPLCRTATAVGTPSVAEAAALCA… |
| A0A661PQM1 | 346-466 | None |
| A0A327V3I0 | 58-197 | None |
| A0A2V3X844 | 209-353 | None |
| R6CXL0 | 74-196 | None |
| A0A7V3F938 | 247-371 | None |
| A0A1I2KKV6 | 4-124 | None |
| A0A0F2J426 | 136-260 | None |
| A0A7J0CKK2 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.