DPCstruct | MC55730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 158 ± 25 aa |
| Standard deviation of domain lengths | 25.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A164S3X5 | 1-150 | MAVNFGLRVKRIWQKSFPQICMYKFSGIHVRHIHKNSSYCRSKEPNQLVVTSSTFNAPEGDRNKDTFLEAVKIYTTRPGPRRSQVEF… |
| A0A2A6CPN8 | 1-117 | MKSRQFDTVPREERNKKAFHAAITIFKERRSRQHVEFIHSALKYVKEFGVHKELDTYKALLNIFPKGKMIPQNTFQRIMLHYPQQQN… |
| A0A6P8ZW98 | 37-196 | None |
| A9V8X9 | 1-175 | None |
| A0A673XY18 | 10-203 | None |
| A0A226NP11 | 25-170 | None |
| T2M6R8 | 55-198 | None |
| A0A834PBM1 | 2-152 | None |
| A0A3S1BRD8 | 103-259 | None |
| A0A090LKL1 | 1-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.