DPCstruct | MC5573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 71 ± 9 aa |
| Standard deviation of domain lengths | 8.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 53.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1K1KLI8 | 1-67 | MKVGLRTPSLKRSIKARTTGKLKRQVKSAVNPLYGKKGMGFIKNPEKSVKNAIYHRTTFGVGDLVKT |
| W1Q4R2 | 22-93 | MKFGLRTPSLKKRLSARTSGAMKRKIKRALIPGYGRRGRGWLTNPRKALYNKIYRKTTVGCLLPFLISASLV |
| A0A2I8AHG1 | 1-66 | None |
| B1BPS7 | 1-61 | None |
| A0A1I7G4V2 | 1-68 | None |
| A0A380K6J8 | 1-63 | None |
| A0A0F4M571 | 2-65 | None |
| A0A173X027 | 2-75 | None |
| K1LXN7 | 1-78 | None |
| D4M566 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.