DPCstruct | MC55729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 13.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 37.23 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF05699- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A164R7U0 | 1-122 | MLSFADDVFRTLPLVKPKNARKLGPPSLSSLLKKFPVLYDHCNADMAEKEWRSHVNLPNDYFYVLSSHSNFEFYNTDAEFYWNRVFA… |
| A0A811X7W2 | 39-133 | KDRFDFSYPVFDTISILDPKVAQAFERKDLNEVLKRFPVLKTVVDELALHKEWREHALLDHATLELDPSLTATSYWNMVFKLRNITK… |
| E9G4X0 | 302-444 | None |
| A0A835L3Y3 | 25-153 | None |
| A0A6S7HSU9 | 2-109 | None |
| A0A6S7KGL4 | 88-211 | None |
| E9GZE8 | 12-136 | None |
| E9HKL3 | 387-511 | None |
| A0A2G8KD77 | 22-143 | None |
| E9HKM2 | 258-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.