DPCstruct | MC55728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 288 |
|---|---|
| Mean domain length (aa) | 240 ± 52 aa |
| Standard deviation of domain lengths | 52.05 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 73.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A164PYP3 | 5-254 | RVIDALCSAAVITPIVDLDKSNAERRSRICASALENFKRNILSSENDSSLELKSSDYSELMKAVKQKIKSTEKRGQKLSLLTLAPAS… |
| A0A820RC81 | 21-205 | LHHEMKVKHTKRMKIYRQCLTGQAKQDYDKRHAESQRTYRNKKKISINGYSTKQSLAKAIKKATHTLPKDLGKKKEVVRVLAQTVGI… |
| A0A819QI70 | 313-544 | None |
| A0A2B4SM98 | 82-388 | None |
| A0A2B4S6J4 | 118-367 | None |
| A0A2B4S5I1 | 34-263 | None |
| E9G9K5 | 23-307 | None |
| A0A1I8I361 | 46-340 | None |
| A0A815QB15 | 8-218 | None |
| A0A7E5W3B0 | 137-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.