DPCstruct | MC55727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 274 ± 26 aa |
| Standard deviation of domain lengths | 25.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 15.11 |
| Pfam Score | 72.32 |
| Assigned Pfam label(s) | PF09175- CL0741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4J2U3 | 16-270 | KNNLTMEFDADILIGKTDNIHLKVDGKRSEMYKEMLLNDPLGKECLQDISKNNLYQKACYKMLLKAHAPDYFKGTLSYKDLKNTDEA… |
| A0A0A9WS01 | 1-285 | MISFMLQMALDVEAKMPNVPLANYRKALEADATSQISAVLNFGEKGSSGAQVSLQGKIRQSSERRDYVRSHPMSALCEQQMQQGNNI… |
| A0A6I9XBE0 | 9-299 | None |
| A0A0B1RQG7 | 108-375 | None |
| A0A3Q0J6A6 | 175-452 | None |
| A0A833W601 | 318-593 | None |
| A0A7R9EN68 | 1-239 | None |
| A0A1B6MSS2 | 22-296 | None |
| A0A0P6CYT5 | 82-357 | None |
| A0A484B9U2 | 1-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.