DPCstruct | MC55726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 96 ± 14 aa |
| Standard deviation of domain lengths | 13.71 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 49.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498NMP3 | 3-80 | DWVCLSPAEFSQLQQYSEYSSKKLKDVLEEFHGNGVLSKYNPEQPIDYEGFQLFMTTYLENDIPEELCKHLFTSFKSK |
| A0A834C3G2 | 7-94 | PEVKELNPVDFIQLQQYIEYCSLKVKDVLREFDADGDLAQHRHGECINEEGFRLFLKTYLEGEELPADLCQRLFRSFQNSESTQEQKN |
| A0A1Y3ERS3 | 1-113 | None |
| S4RWU6 | 1-85 | None |
| A0A210Q1M3 | 1-86 | None |
| A0A6J0WSB2 | 1-87 | None |
| A0A0V1BUL2 | 1-115 | None |
| A0A7R9KNU4 | 4-110 | None |
| A0A7R8X7D5 | 2-107 | None |
| A0A2Y9RKX9 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.