DPCstruct | MC55725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 216 ± 31 aa |
| Standard deviation of domain lengths | 30.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 65.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A164I8Y6 | 1-197 | MIFFYGFLSHRPQGEDVPNFPELRELGDLSDGMSLLGLLAFYAPDLVDWTRIATNEPFSMADCLYNLELVHKFCSESIPNNIFHLGL… |
| A1ZAU8 | 148-380 | NNYQAPTGQSYEQALLGWISHACAALKKRIIKEVDAGLPDDNGSRLQTPDIPPVRDFQDLCDGICLALLISYYCPKVVPWTSVRINY… |
| A0A2A2K839 | 159-418 | None |
| A0A674C1N5 | 174-436 | None |
| A0A1I7WPW1 | 141-310 | None |
| A0A182TR31 | 1-261 | None |
| A0A4W5RKD3 | 240-420 | None |
| H2PA85 | 168-368 | None |
| A0A3S2PIG2 | 220-428 | None |
| A0A1B8XU82 | 1-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.