DPCstruct | MC5572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 160 ± 46 aa |
| Standard deviation of domain lengths | 45.50 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 91.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02596 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M4M1T1 | 64-252 | TAYCVMVEKATRGFRFKSKLSNHGCDGGTTALSLEDSNETIESGREYFSYNLYATNATAYRMRKEIKSLHRAGFTTYGVLIQPLDDF… |
| A0A117L6X9 | 22-150 | RELTCGGAEVALGFSKPLFGEARLSGTKGVLLSPLQKMDEADVVLIVATPSRIMRIAELYSKIEGPIEASFSGDAAVCGEATATPFI… |
| A0A2V7HE35 | 51-226 | None |
| A0A7C0Y786 | 119-338 | None |
| A0A843E0G8 | 2-98 | None |
| A0A2A5P0J4 | 56-280 | None |
| A0A1V4S8J5 | 2-97 | None |
| A0A7C7QQ31 | 21-202 | None |
| A0A812P0D9 | 551-776 | None |
| A0A6B1GPF6 | 28-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.