DPCstruct | MC55719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 4.64 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 73.47 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0036- CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7KWQ5 | 182-253 | DAGADVCFIDALGSVEEMKAFCQVAPRVPKLANMLERGGKTPILNPQELDQVGYKLAVYPLSLMGVSIRAMQ |
| A0A0D2KL38 | 39-113 | EAGADVLFIDALASADEMRAFCGLGGAAAGVPKMANMLEGGGKTPIMAPEELQAMGFALVAYPLSLLGVSIRAMQ |
| A0A317Y2A3 | 344-422 | None |
| A0A2P5FCQ5 | 43-114 | None |
| A0A3L6DMF3 | 192-270 | None |
| A0A1Y1HZA0 | 80-149 | None |
| A0A427B151 | 73-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.