DPCstruct | MC55717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 72 ± 13 aa |
| Standard deviation of domain lengths | 13.26 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 95.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 56.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8J064 | 16-83 | ISAKSEGTKIKLLWGTAQLFFHPRYMHGAATSSEVGVYAYAAAQVKKAMEVTHYLGGENYVFWGGREG |
| Q1ZW60 | 135-188 | LKLLWGTANAFSNPRYMSGAATNPNPEVFAYAASQISHAMEATKRLGGENYVLW |
| A0A7E4S0R0 | 85-167 | None |
| A0A4P0YJG9 | 14-67 | None |
| A0A5S9M8Z3 | 129-211 | None |
| A0A4Q2RG53 | 523-605 | None |
| A0A821WKT5 | 141-223 | None |
| A0A1D6QER4 | 166-248 | None |
| A0A380FNF4 | 2-64 | None |
| A0A2X3D6P8 | 14-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.