DPCstruct | MC5570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 234 ± 25 aa |
| Standard deviation of domain lengths | 24.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3KLC1 | 8-250 | IINKFIEDFLKIKNEGFIESHRSHNTGIGKTFEDLIGVAENNSQMNDYMNLIEIKSQRKKAESYITLFTKSPTNPVNANKILKESYG… |
| A0A3Q9JKG3 | 9-218 | KLQLDKLRNIIGFKEPNSSKQPDYLGIELKTTRQFSKKRSTIFAQVAEWKNSVIKSSAEMLDKYGYSREDSYKLYCTVRAGIANPQG… |
| X6LA41 | 207-467 | None |
| A0A3M0A0J9 | 4-271 | None |
| A0A015T196 | 31-265 | None |
| A0A2H9T4X6 | 252-479 | None |
| A0A5B9P870 | 76-309 | None |
| A0A657BCJ1 | 94-318 | None |
| A0A316SKV4 | 5-213 | None |
| A0A1E5IL87 | 12-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.