DPCstruct | MC557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 114 ± 11 aa |
| Standard deviation of domain lengths | 10.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18932 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z0TUP4 | 1-95 | MKQPSNRNHLFKPGQSGNPLGRPQGARSKFSEAACADALADWTTNGRATLERVRATDPSTYLRVLFSIIPKDIAVSIENRTGPMDGV… |
| A0A4P7BY26 | 1-106 | MTDKRKTLPQLFKPGQSGNPAGKPKGTRNRLSEDFLRDLHEDWQKQGKDVLAAVRKRNPAAYLKVVASLIPKEVPGHFLDELKEMST… |
| A0A220W6L6 | 2-129 | None |
| A0A1M7UW74 | 7-127 | None |
| A0A1Q7BY37 | 1-129 | None |
| A0A1Q7BU36 | 1-102 | None |
| A0A1M3PTC3 | 34-150 | None |
| A0A1W2D3L8 | 1-110 | None |
| A8HTH6 | 99-219 | None |
| A0A2A4XRX2 | 16-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.