DPCstruct | MC55697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 575 ± 89 aa |
| Standard deviation of domain lengths | 88.74 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8MES6 | 2-568 | PFVLLSGEKWIKHNGSNFYVDFSQRFKQDQKDAGDGKGTSKVLLDRIAEMESEAQKSFMHRFNIASDLMDQAKDTGELGLAGILVWM… |
| A0A3M0X2A4 | 266-788 | TTPCNGDLVKLFIDIEHNAKSWREKLNSIYNILREYKDTDFIDELLIYTAIYLRFLGTGEIQCSEDGRHFRPNHLARVSKQIQELLL… |
| A0A5J4Z5T7 | 78-822 | None |
| A0A5J5RLC4 | 1-494 | None |
| A0A383WH22 | 54-790 | None |
| A0A843UGM5 | 480-937 | None |
| A0A6A6NFN2 | 7-397 | None |
| A0A7S0R8Y9 | 1-498 | None |
| A0A2C6LBP0 | 7-476 | None |
| A0A5D2KYR5 | 46-677 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.