DPCstruct | MC55696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 13.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 56.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L9TXD7 | 1-119 | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNITGGAITN… |
| A0A7J8M9N5 | 1-111 | MSLPWYRVHTVVLNYPGRLLSVHIMHMALVASWAGSMALYELVVFDPSDPVLDLIWRQWWTITNPGIWCYECVAGAHIVFSGLCFLA… |
| A0A814RG48 | 1-122 | None |
| A0A7J8N073 | 1-95 | None |
| A0A6J4MT60 | 11-116 | None |
| A0A7J7LK22 | 2-105 | None |
| A0A0X8WVE5 | 1-138 | None |
| A0A6A4NTL6 | 41-169 | None |
| A0A5A7T7Y5 | 128-261 | None |
| A0A1R3L2P1 | 1-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.