DPCstruct | MC55684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 119 ± 22 aa |
| Standard deviation of domain lengths | 21.83 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.40 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF10046- PF15749 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A8DP91 | 2-126 | PNYIGVQCAQCEAFQVVQQPKSKKWKCRMCDHGQSVVRLFAGSSKAAEVRPVVQRLNRLRGRKAELEEELLEMMRDGRIDEETIRAA… |
| A0A1D1VEB4 | 1-97 | MPQAVLVLQCGNCQTHQGQLAKTTASWTCKICNQKQPLNNVLFEGTGKQCREKVQQLNMQRGIEETQRICDVHQQDENILRMKLEDE… |
| M1V8B0 | 3-132 | None |
| T2MAX0 | 1-132 | None |
| A0A2T7DHK2 | 42-176 | None |
| A0A0M5JAZ5 | 1-108 | None |
| A0A4S8JAB0 | 30-148 | None |
| A0A3M7S5G3 | 75-174 | None |
| A0A060X290 | 1-80 | None |
| A0A6F9DL88 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.