DPCstruct | MC5568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 129 ± 12 aa |
| Standard deviation of domain lengths | 12.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4WU54 | 3-112 | TPWSKLSERQQADKIDAINRSAETLVRKAVSLVANQGFPHLSIRLGKWSVNGEMKLEVSGAGSVDNITKLAEHGAGEAILVLTEVGD… |
| A0A3Q9JGZ4 | 17-146 | IEEMTTHTIGESLMQLVIQEFKAMPDVWQKMPEAKQRDVIDRARENVSKAVKNAVRLIASEGKPIISGVVEQVNAKAGLELKIKVAG… |
| A0A841A444 | 18-142 | None |
| A0A2S8ETW0 | 12-142 | None |
| A0A1Y6CZH1 | 296-427 | None |
| A0A0P9Z1P8 | 19-131 | None |
| H8FP54 | 36-158 | None |
| A0A0Q5HS48 | 117-246 | None |
| A0A421A536 | 4-151 | None |
| C1D8I9 | 12-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.