DPCstruct | MC55674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 6.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 62.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A699IN83 | 1-76 | MEISLCQNVPAAMGFTFAAGTTDGPGAFDFTQGDDQGNAFWNLVRGLLKKTDEKQIKCQDPKPIVIDSGEMHEPYD |
| A0A0A9D4I6 | 164-230 | PAAMGFASAAGTTDGPGAFDFKQGDVKGNPFWRLVRNLLKPPGKEQVECQSPKPILLDTGEMKEPYD |
| A0A2G3BL68 | 28-102 | None |
| A0A6J2YHV6 | 109-182 | None |
| A0A453F2X0 | 269-341 | None |
| E0W4J0 | 1-64 | None |
| A0A7J9ENI6 | 354-420 | None |
| A0A0R0EX84 | 448-520 | None |
| A0A183KCD1 | 149-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.