DPCstruct | MC55671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 122 ± 19 aa |
| Standard deviation of domain lengths | 18.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 66.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 40.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A699IGF5 | 1-140 | MTYTTSIMKTKAAQYDLLSIKDMVPNIWSPIKNDYDKHALWGISHWRDQRKTFYGYARGLESTHDVYSTKHILAVTRVKAMQKHRYE… |
| A0A699IRN5 | 343-454 | YHIDHMKNFLKSGIRDPEARYGVEHWKNPHAKIFYIRKQKEPGKPKEVIYSNSKIIQVIKTYWELGHEHKFITEIISRRANECIVSI… |
| A0A6L2NEL7 | 343-470 | None |
| A0A6L2NTJ0 | 2-129 | None |
| A0A6L2NU71 | 24-178 | None |
| A0A6L2NUL9 | 184-299 | None |
| A0A6L2J9K8 | 53-154 | None |
| A0A6L2JAB4 | 36-155 | None |
| A0A6L2JJ36 | 3-103 | None |
| A0A699GT07 | 209-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.