DPCstruct | MC5567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 6.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 25.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q6US82 | 2-74 | YNHETVSLDGEHFSGCEFRGCRLIYAGGEAPTFDNCRFENCEWKFDDAAERTLAHLKVVWNNGGKAPVQAMIK |
| A0A2N9LTG3 | 2-72 | TRHENKIFENQHLVLDDGIFVNCTFKNCSLEYSGGDVYVQNCQGEGCQLVWRAAAQRTVMLLQGLGLMVAP |
| A0A2K8YTM8 | 70-163 | None |
| A0A2I9D5G2 | 31-118 | None |
| A0A7W7A8I5 | 6-85 | None |
| A0A3C1WGH1 | 9-92 | None |
| A0A4S3LD26 | 40-121 | None |
| L0DEA1 | 2-89 | None |
| A0A6L9IEY4 | 2-86 | None |
| A0A1Q8B7K0 | 136-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.