DPCstruct | MC55668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 122 ± 18 aa |
| Standard deviation of domain lengths | 17.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2JSM6 | 10-111 | HIDQDEYPAQRLASEIFVETGVRAMERGNVSKGRNPETGENYRPSLELVRLTIPRRVYTNDHMQAVADGIIRLYQRREEIKGLRFVY… |
| A0A090PVJ8 | 22-125 | FLDAKRYCQHLSLEQLPAQSLAASLYQHTGIRAMERGVVSAGKSEEHALETVRLTIPRRVYTYSHMDEIAERVADHYQNREQIQGLV… |
| A0A0D2MC86 | 23-166 | None |
| A0A7I8VBV8 | 328-457 | None |
| A0A3G1J0L9 | 845-975 | None |
| A0A7C3YXR8 | 9-106 | None |
| A0A7K0YYK1 | 119-247 | None |
| A0A7S3MT16 | 95-236 | None |
| A0A7S3Z8G5 | 353-483 | None |
| A0A3S3DTA8 | 115-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.