DPCstruct | MC55663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 5.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090P340 | 1-65 | MKVVVVKCDNDGNIDLVDLAEKIEKHRENLSSIMITYPSTHGVYEEQVKQVCEMVHEAGGQVYLD |
| A0A656B1S1 | 456-533 | MKVVVVKCDENGNIDMVDLADKIEKHKDHLSSIMITYPSTHGVYEQQVREVCEMVHAAGGQVYLDGANMNAQVGLTSP |
| A0A212C5U0 | 532-600 | None |
| A0A365NFS7 | 421-499 | None |
| A0A2X2CCI0 | 402-470 | None |
| A0A6A5L9W1 | 608-676 | None |
| A0A6G3VRI8 | 223-289 | None |
| A0A376ZS06 | 1-62 | None |
| A0A6A1W662 | 688-756 | None |
| A0A533IVI5 | 393-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.