DPCstruct | MC55651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 117 ± 26 aa |
| Standard deviation of domain lengths | 26.35 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 90.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7Y477 | 2-105 | KNSKLYETVNEGVIKCLVCERRCLLTPGRKGVCRNYLNVEGRLEHLGYGRLSAVKSRPIEVKPLFHYWPGSTALTYSTWGCNFYCPW… |
| A0A7C7KZD4 | 11-150 | HCELCEWRCGVDRLAGELGACRIGIPQVASMTLHPAPPSSYTIFLAGCNFRCLHCQNWSIAHYPDTNVAIHGWIDPDAVASDGIEQI… |
| S7HST0 | 1-90 | None |
| A0A850M6D8 | 7-132 | None |
| A0A3D0Z0M9 | 2-104 | None |
| A0A0P9DXD6 | 1-87 | None |
| O50254 | 3-108 | None |
| A0A2V9X3S3 | 11-130 | None |
| A0A7V0XFH3 | 34-150 | None |
| A0A842T769 | 54-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.