DPCstruct | MC5565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 101 ± 20 aa |
| Standard deviation of domain lengths | 20.09 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.05 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0664- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3R159 | 104-192 | GSKVIEFGETIALQGFKEELYRWGYHFVDIASQQGEVSFRGDIIDVYPTSAEQPYRISLFDEEVESIRRYDAKSQKSIQEELERLEI… |
| A0A0B4E3K0 | 96-188 | QVFQVGKEYSLSFLKETLEKYHYRRNYLLEKRGEYSIRGDILDIFPYTDSFPVRIEFFGEEIERISYFEIENQKSFQSMTEYKMYID… |
| A0A7T8XVD6 | 273-364 | None |
| A0A1W1DE25 | 99-217 | None |
| A0A2X5PBE3 | 82-189 | None |
| S4N1D5 | 11-104 | None |
| A0A554JHU3 | 156-275 | None |
| A0A855HGA9 | 55-177 | None |
| A0A0K2RFG3 | 2-80 | None |
| A0A812IYI2 | 195-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.