DPCstruct | MC55646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 240 ± 33 aa |
| Standard deviation of domain lengths | 32.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388QSN0 | 1-255 | MPRLLLVLLCAASGSAAEPSQKLTVTEATAETRTLLKGRKISDILGVTHVNGQYALSEKPFLLEGAAATQQLGSKVLKLWFYPIYAE… |
| A0A660QHJ3 | 195-403 | TENSEIIGSSHVNQRYYFGTEDCLNEGANTLLAMGSKVIKVWYWNGYETPNNFYPWNSSWPASIASLADGLNNTHYTDLFDKPFKTF… |
| A0A6G3ZNY0 | 5-227 | None |
| A0A2R6MFN3 | 298-502 | None |
| A0A0G4I3A5 | 174-439 | None |
| A0A1V5FKV9 | 1-283 | None |
| A0A537A6M7 | 1-226 | None |
| A0A1Q2MJC5 | 1-290 | None |
| A0A0Q9YXD8 | 313-511 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.