DPCstruct | MC55644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 132 ± 22 aa |
| Standard deviation of domain lengths | 22.40 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388PC92 | 32-156 | LPNLAKNADDICWMRSLNTEAINHEPAICAMQTGNQITGRPCLGSWASYGLGSANDNLPSFVVLIATPTNRDQEQAISSRLWSSGYL… |
| A0A2V8VJT5 | 3-118 | IAILRSLQTTQFNHAPGQMFMNTGFQFFGRPGMGSWLTYGLGSEASDLPGFVVLLSGENEPDGGKACSGSGFLPTVYQGVQFQSAGD… |
| A0A1N6DNS1 | 677-805 | None |
| A0A838QR89 | 1-155 | None |
| A0A2D6HBA0 | 1-99 | None |
| A0A2D5VD17 | 3-116 | None |
| A0A2H6AFF3 | 133-254 | None |
| A0A7C7Z897 | 105-226 | None |
| A0A812LYU4 | 825-960 | None |
| A0A5C9CF12 | 109-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.