DPCstruct | MC55642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 203 ± 45 aa |
| Standard deviation of domain lengths | 45.29 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00902 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8IW58 | 9-237 | SNIRLQSHTEELFARTGLLIFAWIIVSIPWLMNIDSVLEFLIIKLDPCEVECLNLYQPEKWSELRWLASAILGFATILPLMSQQFWS… |
| J7K8E6 | 19-208 | RDFIFTELTEGLYITVKVCSFATLCAVSPLAVYQAWCFALPSLYRAERKRWNLLWGFSLLLFVLSLILAYLILLPKIVTLLLQFEIK… |
| A0A6B9FAM6 | 243-482 | None |
| A0A4D6C549 | 4-233 | None |
| A0A534S537 | 2-148 | None |
| A0A3B0YMP8 | 19-259 | None |
| A0A2R6IE01 | 26-252 | None |
| A0A0Y1CNS4 | 119-369 | None |
| A0A7K0PK37 | 99-330 | None |
| A0A523D9N9 | 90-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.