DPCstruct | MC5564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 7.89 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 42.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1DEY6 | 80-187 | ELVKRVCGVCGGKKVIHARCRCGGKGEVLDRKATKELGAPVFKTCERCSGNGFSVVPSATVHRAILKRLPDLHQSSWSRNWKPFYEG… |
| A0A077PAR3 | 24-133 | EKEQVGELCQKCNGKGTLSNRCRCKGRGVVADEEKTALQGVPVDKICPRCSGRGYSRMPSSVAYTAIKAYLPELNERTWRRNWKPFY… |
| A0A0T9V0Q1 | 29-138 | None |
| A0A2G8EKI2 | 77-164 | None |
| A0A822P676 | 59-169 | None |
| A0A6M1CLR2 | 1-108 | None |
| A0A483RB31 | 83-187 | None |
| A0A7I7G2D4 | 118-225 | None |
| V5TW91 | 92-201 | None |
| A0A5X4PE15 | 107-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.