DPCstruct | MC55633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 53 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 48.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6M4J7 | 269-320 | TNSDLDGDGFTPDQGDCDDANEFVYPGATEINDGIDNDCDGEVDEITPDTPS |
| A0A7C1ZKN4 | 33-86 | FQKPVDNDKDGFSQNARKNIDCDDNNPNIHPEAEDIAGDGIDQDCDGNDAKLDI |
| A0A521UC79 | 145-195 | None |
| A0A2N6EVA4 | 391-445 | None |
| A0A850BRA1 | 2-50 | None |
| A0A2G6N617 | 200-248 | None |
| W2UN91 | 222-267 | None |
| A0A661NYQ6 | 736-784 | None |
| A0A3A8HWV6 | 169-228 | None |
| A0A7Y4QFT7 | 49-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.