DPCstruct | MC55632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 94 ± 15 aa |
| Standard deviation of domain lengths | 15.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1C164 | 19-104 | HLTQSVEVTLPKPKISTSLWDDEGTVCYQVDVRGICVTRRQDNDMINGTKLLNVTGMSRGKRDGILKNEKGRVVVKVGAMHLKGVW |
| Q6FJB4 | 122-193 | VITTYWEDEHTICHGVNHNGVTVVRRADNDMVNGTKLLNVTGMTRGRRDGILKNEPVRDVVKGGPMTLKGVW |
| A0A0M8MUY0 | 3-101 | None |
| A0A4U0V3U7 | 59-162 | None |
| A0A1V2LLD2 | 103-191 | None |
| A0A1E4SMC6 | 163-260 | None |
| A0A146H7Z8 | 232-331 | None |
| A0A168JGI4 | 7-79 | None |
| A0A6A5URC7 | 1-100 | None |
| A0A077W9S9 | 7-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.