DPCstruct | MC5563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 146 ± 18 aa |
| Standard deviation of domain lengths | 18.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q5ZS80 | 39-200 | IYIVKDRNSEQYNSLINYSNFDTTRKIQKIEALGLNSKWLPLYKYIGKYYLYIPCDRMNDGKYLIDDNTIQISSSEITDYDIDSLEK… |
| A0A2E4EHS7 | 17-152 | GEPVQLNKFYKTNLPEGFHRNWYKLTETDSGYIAYKPCDAANKSINLTEGSVTIDYGQEEVVFEVLNIDSNRRGFYRFILETDHSLD… |
| A0A6N4H8E5 | 89-266 | None |
| A7LZD3 | 14-151 | None |
| A0A7H9DSX9 | 18-156 | None |
| A0A1M5VXG5 | 51-248 | None |
| A0A396M3C7 | 129-272 | None |
| A0A7W5H1U5 | 10-160 | None |
| A0A0C1G4C5 | 5-130 | None |
| A0A5N7UW36 | 27-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.