DPCstruct | MC55628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 190 ± 33 aa |
| Standard deviation of domain lengths | 32.90 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04387 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1BSI7 | 17-188 | KNFTEWYLLSYNQVSFLGWFWILYLTISKLYETQGDYRPVFDLVWPSLQYVQTAAVFEVLHSLFGFVRAPIMTTGMQVASRLFLVWA… |
| A0A1E4TTA4 | 12-196 | WISYYNYGCAALWSYILIATIYYPFIKGYDQFSFYEKTNFTLTIIQSLAIVEIYNSAVGNVRSPVFTTVVQVSSRLLVVWGIFQILP… |
| A0A177AUL1 | 39-270 | None |
| M1VL10 | 44-274 | None |
| A0A7R9Q981 | 2-166 | None |
| A0A7R9YBW2 | 4-222 | None |
| A0A182F9F3 | 227-433 | None |
| G8BKZ7 | 2-157 | None |
| A0A4W4GAG1 | 4-176 | None |
| A0A3S3PQD4 | 121-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.