DPCstruct | MC55624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 146 ± 23 aa |
| Standard deviation of domain lengths | 23.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2TC51 | 4-128 | GDCGVTYVCLFCPDSGCDFNQAWQHMKEVHGFDFKKLKETHQLNFYQQIRLVNYIRKKMHEKECMVCDLKFCFHGDLLCHLTTSGHL… |
| I1BJ22 | 6-140 | YEEDYDPQEHTWDDWSEEEEEQQVQCLYCKDISPSAKEVLQHMKSAHTFDFQNTRKTLQLDFYQCIRLINYVRYKVQEDASYSCTTF… |
| A0A1Y1W8S1 | 338-479 | None |
| A0A5J4Z289 | 75-217 | None |
| A0A7M5TXK0 | 1-148 | None |
| A0A0N0P8N5 | 131-318 | None |
| A0A6I9PUD5 | 14-178 | None |
| A0A4Z2H089 | 13-167 | None |
| A0A2U1JAI4 | 11-151 | None |
| A0A044UB88 | 434-584 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.