DPCstruct | MC55619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 10.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.40 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0236- PF01253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182KGG4 | 2-82 | AIHFHEILKTFYTLGCEDEALCYGACRVYIYLKEEKHMHDVQYMYEKQLQLFYLTARKEPDALTDLFVPALTTDAFNLVQL |
| A0A672T3D3 | 2-98 | DEVNRADPPSWIQQHAYQDLMHLDVGDSAQVYAAFLVYMDLTEVRKWKEVVGVSCPELQAVLLEGREKEGETVQMVYPLPSHRSIKH… |
| A0A6I9KGR3 | 17-89 | None |
| A0A4W6FJF3 | 10-103 | None |
| H3AXP3 | 7-113 | None |
| A0A4W2H0H6 | 250-361 | None |
| A0A2D4PS01 | 35-128 | None |
| A7RUN4 | 453-543 | None |
| A0A2K6B7H4 | 27-116 | None |
| A0A7J8BHJ7 | 5-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.