DPCstruct | MC55616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 139 ± 25 aa |
| Standard deviation of domain lengths | 24.87 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V4H7Z6 | 14-131 | MNKNTEWFMYPGIVIPKPRSFPEITYHFFHWKKGTPFSDDQGIYNSLTWWEQIDNGKQLTRNRKFLTVVPVVLNNFVMLCCYFTTDP… |
| A0A1U8L4A2 | 13-125 | LFFTWLLVLSVFGCSPSMAWTIINLSHFLITCHFFHWKKRTPFAEDQGMYNGLTWWEQIDNGKQFTPNRKFLTIVPVILYLIASYTT… |
| A0A0D0SYV6 | 1-114 | None |
| H9GMB9 | 242-403 | None |
| A0A0S4JRJ8 | 15-155 | None |
| A0A6G0X563 | 15-159 | None |
| R9PCV2 | 9-150 | None |
| A0A834AYC1 | 2-93 | None |
| A0A0P1B7T6 | 5-113 | None |
| M3D8F6 | 308-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.